A Professional Backline Instrument Rental Service & Cartage Company in Orlando. We delivers complete solutions by Quality Drums, Guitars, Amps and More. Call: 407-703-3900

1.67 Rating by CuteStat

backlineinstrumentrentals.com is 6 years 10 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, backlineinstrumentrentals.com is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

192.254.234.33

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 13
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 8 Total Images: 50
Google Adsense: Not Applicable Google Analytics: UA-74789301-1

Websites Hosted on Same IP (i.e. 192.254.234.33)

E-rim | Upgrade your bike to an e-bike

- e-rim.com

Simply replace your front bicycle wheel with the E-rim. Instantly receive a 30 miles range with 16 mph top speed. Put on more miles in a breeze.

294,229 $ 30,240.00

EZ Tutorials for Beginner to Advanced - Tutsout

- tutsout.com

If you are in geo1, call us today! Tutsout

Not Applicable $ 8.95

Breakfast Sandwich Maker Recipes

- breakfastsandwichmakerrecipes.com
Not Applicable $ 8.95

Drew Martens | Creative Perceptions

- drewmartens.com
Not Applicable $ 8.95

HostGator Web Hosting Website Startup Guide

- donnabellpsychotherapy.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Wed, 28 Jun 2017 01:10:43 GMT
Server: Apache
Cache-Control: private
ETag: W/"fe992c04d635e9036f7d3f295886ddad-gzip"
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
X-Host: pages13.sf2p.intern.weebly.net
X-UA-Compatible: IE=edge,chrome=1
Content-Length: 23053
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: Launchpad.com Inc.
Registration Date: Jun 26, 2017, 12:00 AM 6 years 10 months 2 weeks ago
Last Modified: Jun 26, 2017, 12:00 AM 6 years 10 months 2 weeks ago
Expiration Date: Jun 26, 2018, 12:00 AM 5 years 10 months 2 weeks ago
Domain Status:
clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ns113.hostgator.com 192.254.234.252 United States of America United States of America
ns114.hostgator.com 192.254.234.253 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
backlineinstrumentrentals.com A 14381 IP: 192.254.234.33
backlineinstrumentrentals.com NS 86399 Target: ns6490.hostgator.com
backlineinstrumentrentals.com NS 86399 Target: ns6489.hostgator.com
backlineinstrumentrentals.com SOA 86399 MNAME: ns6489.hostgator.com
RNAME: root.gator3245.hostgator.com
Serial: 2017062703
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
backlineinstrumentrentals.com MX 14399 Target: mail.backlineinstrumentrentals.com
backlineinstrumentrentals.com TXT 14399 TXT: v=spf1 a mx include:websitewelcome.com
~all

Full WHOIS Lookup

Whois Server Version 2.0

Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.

Domain Name: BACKLINEINSTRUMENTRENTALS.COM
Registrar: LAUNCHPAD.COM, INC.
Sponsoring Registrar IANA ID: 955
Whois Server: whois.launchpad.com
Referral URL: http://www.launchpad.com
Name Server: NS113.HOSTGATOR.COM
Name Server: NS114.HOSTGATOR.COM
Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Updated Date: 26-jun-2017
Creation Date: 26-jun-2017
Expiration Date: 26-jun-2018

>>> Last update of whois database: Wed, 28 Jun 2017 01:10:54 GMT